Atlas Antibodies Anti-RAI14 Antibody

상품 한눈에 보기

인체 RAI14 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG로 고순도 정제되었으며, 인간과 마우스에 반응성을 보입니다. 40% glycerol 기반 PBS buffer에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036950-100 Anti-RAI14 Antibody, retinoic acid induced 14 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036950-25 Anti-RAI14 Antibody, retinoic acid induced 14 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: retinoic acid induced 14
Product Type: Polyclonal Antibody against Human RAI14

Immunohistochemistry (IHC)
Western Blot (WB) — Orthogonal validation using RNA-seq comparison in high and low expression cell lines

DKFZp564G013, KIAA1334, NORPEG, RAI13

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ISPTQLSDVSSPRSITSTPLSGKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLTLHNKELQDK

Human, Mouse

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000022246	96%
Rat	ENSRNOG00000028872	94%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.