CacheBy
Atlas Antibodies Anti-RAI14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RAI14 Antibody

상품 한눈에 보기

인체 RAI14 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG로 고순도 정제되었으며, 인간과 마우스에 반응성을 보입니다. 40% glycerol 기반 PBS buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036950-100 Anti-RAI14 Antibody, retinoic acid induced 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036950-25 Anti-RAI14 Antibody, retinoic acid induced 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RAI14 Antibody

Anti-RAI14 Antibody

Target Protein: retinoic acid induced 14
Product Type: Polyclonal Antibody against Human RAI14

  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Orthogonal validation using RNA-seq comparison in high and low expression cell lines

Alternative Gene Names

DKFZp564G013, KIAA1334, NORPEG, RAI13

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

ISPTQLSDVSSPRSITSTPLSGKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLTLHNKELQDK

Verified Species Reactivity

Human, Mouse

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022246 96%
Rat ENSRNOG00000028872 94%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Validation
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.