CacheBy
Atlas Antibodies Anti-RABL6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RABL6 Antibody

상품 한눈에 보기

인간 RABL6 단백질을 인식하는 토끼 다클론 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간에 대한 검증된 반응성과 95% 이상의 마우스·랫트 교차 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044037-100 Anti-RABL6 Antibody, RAB, member RAS oncogene family-like 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044037-25 Anti-RABL6 Antibody, RAB, member RAS oncogene family-like 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RABL6 Antibody

Anti-RABL6 Antibody

Target: RAB, member RAS oncogene family-like 6 (RABL6)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RABL6.
Affinity purified using the PrEST antigen as affinity ligand.
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Alternative Gene Names

bA216L13.9, C9orf86, FLJ10101, FLJ13045, Parf, pp8875, RBEL1


Target Information

항목 내용
Target Protein RAB, member RAS oncogene family-like 6
Target Gene RABL6
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence LKKLVGSDQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVEEYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVV
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000015087 (95%), Rat ENSRNOG00000016795 (95%)

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Additional Information

  • Gently mix before use.
  • Determine optimal concentrations and conditions experimentally.
  • Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.