AI 생성

1 / 2

Atlas Antibodies Anti-RACK1 Antibody

상품 한눈에 보기

Human RACK1 단백질을 인식하는 rabbit polyclonal 항체로, WB 및 ICC에 적합합니다. GNB2L1 유전자에 대응하며, 고순도의 affinity purification으로 제조되었습니다. Human과 Mouse에 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021676-100 Anti-RACK1 Antibody, receptor for activated C kinase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021676-25 Anti-RACK1 Antibody, receptor for activated C kinase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Receptor for Activated C Kinase 1 (RACK1)

Polyclonal antibody against human RACK1 protein.

Gnb2-rs1, GNB2L1, H12.3

항목	내용
Target Protein	Receptor for activated C kinase 1
Target Gene	RACK1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse
Interspecies Information	Rat ENSRNOG00000052620 (100%), Mouse ENSMUSG00000020372 (100%)

CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.