Atlas Antibodies Anti-RABEPK Antibody
상품 한눈에 보기
Human RABEPK 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석 및 RNA-seq 데이터 기반 직교 검증에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 다양한 종 간 높은 항원 서열 유사성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RABEPK Antibody
Target: Rab9 effector protein with kelch motifs (RABEPK)
Type: Polyclonal Antibody against Human RABEPK
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody raised in rabbit against human Rab9 effector protein with kelch motifs (RABEPK).
Alternative Gene Names
bA65N13.1, RAB9P40
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Rab9 effector protein with kelch motifs |
| Target Gene | RABEPK |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRH |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000070953 (88%), Rat ENSRNOG00000018591 (88%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-RABGGTB Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-RABGAP1L Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-RABEPK Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-RABEP2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-RABGAP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.