CacheBy
Atlas Antibodies Anti-RABEPK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RABEPK Antibody

상품 한눈에 보기

Human RABEPK 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석 및 RNA-seq 데이터 기반 직교 검증에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 다양한 종 간 높은 항원 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023920-100 Anti-RABEPK Antibody, Rab9 effector protein with kelch motifs 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023920-25 Anti-RABEPK Antibody, Rab9 effector protein with kelch motifs 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RABEPK Antibody

Anti-RABEPK Antibody

Target: Rab9 effector protein with kelch motifs (RABEPK)
Type: Polyclonal Antibody against Human RABEPK
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody raised in rabbit against human Rab9 effector protein with kelch motifs (RABEPK).


Alternative Gene Names

bA65N13.1, RAB9P40


Target Information

항목 내용
Target Protein Rab9 effector protein with kelch motifs
Target Gene RABEPK
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRH
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000070953 (88%), Rat ENSRNOG00000018591 (88%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.