CacheBy
Atlas Antibodies Anti-RABGGTB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RABGGTB Antibody

상품 한눈에 보기

Human RABGGTB 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Affinity purification 방식으로 정제되었으며, Human 및 Mouse에 반응합니다. 안정적인 PBS/glycerol buffer에 보존되어 연구용으로 최적화되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026585-100 Anti-RABGGTB Antibody, Rab geranylgeranyltransferase, beta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026585-25 Anti-RABGGTB Antibody, Rab geranylgeranyltransferase, beta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RABGGTB Antibody

Anti-RABGGTB Antibody

Target: Rab geranylgeranyltransferase, beta subunit
Product Type: Polyclonal Antibody against Human RABGGTB

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against the human RABGGTB protein. Suitable for detection of Rab geranylgeranyltransferase, beta subunit.

Open Datasheet

Target Information

항목 내용
Target Protein Rab geranylgeranyltransferase, beta subunit
Target Gene RABGGTB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence REKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVNPVFCMPEEVLQRVNVQPELVS
Verified Species Reactivity Human, Mouse
Interspecies Information Mouse ENSMUSG00000038975 (97%), Rat ENSRNOG00000009992 (96%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.