Atlas Antibodies Anti-PUS7L Antibody

상품 한눈에 보기

Human PUS7L 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 affinity purification 되었으며, 높은 특이성과 재현성을 제공합니다. Human에서 검증되었고 glycerol 기반 buffer로 안정화되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056203-100 Anti-PUS7L Antibody, pseudouridylate synthase 7 homolog (S. cerevisiae)-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056203-25 Anti-PUS7L Antibody, pseudouridylate synthase 7 homolog (S. cerevisiae)-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PUS7L Antibody

Anti-PUS7L Antibody

Target: pseudouridylate synthase 7 homolog (S. cerevisiae)-like
Type: Polyclonal Antibody against Human PUS7L

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting the human pseudouridylate synthase 7 homolog (PUS7L).

Alternative Gene Names

DKFZP434G1415

Open Datasheet

Target Information

항목	내용
Target Protein	pseudouridylate synthase 7 homolog (S. cerevisiae)-like
Target Gene	PUS7L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	YAIHQVVLPVLGYNIQYPKNKVGQWYHDILSRDGLQTCRFKVPTLKLNIPGCYRQILKHPCNLSYQLMEDHDIDVKTKGSHIDETALSLLISFDLDASCYATVCLKEIM

Verified Species Reactivity

Human

Interspecies Information

Species	Ortholog ID	Sequence Identity
Rat	ENSRNOG00000022570	66%
Mouse	ENSMUSG00000033356	65%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)