Atlas Antibodies Anti-PVR Antibody

상품 한눈에 보기

인간 PVR 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 RNA-seq 기반 직교 검증 수행. CD155 등 다양한 유전자명으로 알려진 poliovirus receptor 타겟. PrEST 항원으로 친화 정제된 고품질 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA012568-100 Anti-PVR Antibody, poliovirus receptor 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA012568-25 Anti-PVR Antibody, poliovirus receptor 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: poliovirus receptor (PVR)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal antibody against human PVR (poliovirus receptor).

CD155, HVED, Necl-5, NECL5, PVS, Tage4

항목	내용
Target Protein	poliovirus receptor
Target Gene	PVR
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000062300 (48%), Rat ENSRNOG00000018730 (47%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.