
Atlas Antibodies Anti-PTPRA Antibody
상품 한눈에 보기
Human PTPRA 단백질에 특이적인 폴리클로날 항체. IHC 및 WB 검증 완료. Recombinant expression 기반으로 검증된 신뢰성 높은 제품. Rabbit에서 생산된 IgG 항체로, 친화 정제 방식 사용. 다양한 종간 높은 항원 서열 동일성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PTPRA Antibody
protein tyrosine phosphatase, receptor type, A
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human PTPRA
Alternative Gene Names
HLPR, HPTPA, LRP, PTPA, PTPRL2, RPTPA
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein tyrosine phosphatase, receptor type, A |
| Target Gene | PTPRA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGM |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Reactivity | Human |
| Ortholog Identity | Mouse ENSMUSG00000027303 (100%) Rat ENSRNOG00000021223 (100%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PTPRE Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPRA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPRA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPN4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPN3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.