CacheBy
Atlas Antibodies Anti-PTPN4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTPN4 Antibody

상품 한눈에 보기

Human PTPN4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종 간 보존성을 보입니다. PBS-글리세롤 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019351-100 Anti-PTPN4 Antibody, protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019351-25 Anti-PTPN4 Antibody, protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTPN4 Antibody

Anti-PTPN4 Antibody

Target: protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human PTPN4 (protein tyrosine phosphatase, non-receptor type 4, megakaryocyte).


Alternative Gene Names

  • PTPMEG

Target Information

항목 내용
Target Protein protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte)
Target Gene PTPN4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQVTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000002625 (96%), Mouse ENSMUSG00000026384 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources


제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.