
Atlas Antibodies Anti-PTPN14 Antibody
상품 한눈에 보기
Human PTPN14 단백질을 인식하는 토끼 폴리클로날 항체로, WB 등 단백질 발현 분석에 적합. RNA-seq 기반 직교 검증 완료. Affinity purification으로 높은 특이성과 재현성 확보. 40% glycerol 및 PBS buffer 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PTPN14 Antibody
Protein Tyrosine Phosphatase, Non-receptor Type 14 (PTPN14)
Polyclonal antibody against human PTPN14 protein.
Recommended Applications
- Western Blot (WB)
Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
- Type: Polyclonal Antibody
- Target Protein: Protein tyrosine phosphatase, non-receptor type 14
- Target Gene: PTPN14
- Alternative Gene Name: PEZ
- Host: Rabbit
- Isotype: IgG
- Verified Species Reactivity: Human
- Interspecies Homology: Rat (83%), Mouse (82%)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
PMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTD
Purification & Buffer
| 항목 | 내용 |
|---|---|
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PTPN18 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPN20 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPN14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPN13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPDC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.