Atlas Antibodies Anti-PTPN14 Antibody

상품 한눈에 보기

Human PTPN14 단백질을 인식하는 토끼 폴리클로날 항체로, WB 등 단백질 발현 분석에 적합. RNA-seq 기반 직교 검증 완료. Affinity purification으로 높은 특이성과 재현성 확보. 40% glycerol 및 PBS buffer 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA053864-100 Anti-PTPN14 Antibody, protein tyrosine phosphatase, non-receptor type 14 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA053864-25 Anti-PTPN14 Antibody, protein tyrosine phosphatase, non-receptor type 14 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PTPN14 Antibody

Anti-PTPN14 Antibody

Protein Tyrosine Phosphatase, Non-receptor Type 14 (PTPN14)
Polyclonal antibody against human PTPN14 protein.

Recommended Applications

Western Blot (WB)

Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Type: Polyclonal Antibody
Target Protein: Protein tyrosine phosphatase, non-receptor type 14
Target Gene: PTPN14
Alternative Gene Name: PEZ
Host: Rabbit
Isotype: IgG
Verified Species Reactivity: Human
Interspecies Homology: Rat (83%), Mouse (82%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence:

PMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARVLRHGPAKAISMSRTD

Purification & Buffer

항목	내용
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2)
Preservative	0.02% sodium azide
MSDS	Material Safety Data Sheet