CacheBy
Atlas Antibodies Anti-PTPN18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTPN18 Antibody

상품 한눈에 보기

Human PTPN18 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 제조되었습니다. ICC 등 다양한 응용에 적합하며, 높은 특이성과 재현성을 제공합니다. Glycerol buffer에 보존되어 장기 보관이 용이합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA053367-100 Anti-PTPN18 Antibody, protein tyrosine phosphatase, non-receptor type 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053367-25 Anti-PTPN18 Antibody, protein tyrosine phosphatase, non-receptor type 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTPN18 Antibody

Anti-PTPN18 Antibody

Target: protein tyrosine phosphatase, non-receptor type 18
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human PTPN18 (protein tyrosine phosphatase, non-receptor type 18).

Alternative Gene Names

  • BDP1

Target Information

항목 내용
Target Protein protein tyrosine phosphatase, non-receptor type 18
Target Gene PTPN18
Verified Species Reactivity Human
Interspecies Identity Mouse (68%), Rat (65%)

Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence EEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet
  • ICC (Immunocytochemistry)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Open Datasheet


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.