
Atlas Antibodies Anti-PTPMT1 Antibody
Human PTPMT1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. Human에 반응하며, Rat 및 Mouse와도 높은 유사성을 가집니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PTPMT1 Antibody
Target Protein: Protein tyrosine phosphatase, mitochondrial 1 (PTPMT1)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PTPMT1, designed for detection of the mitochondrial protein tyrosine phosphatase.
Alternative Gene Names
- DUSP23
- MOSP
- PLIP
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
FRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGI
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000009723 | 85% |
| Mouse | ENSMUSG00000110860 | 83% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium azide | 0.02% (preservative) |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PTPN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPDC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPMT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTPA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PTP4A1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|