
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PTPMT1 Antibody
상품 한눈에 보기
Human PTPMT1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 고순도와 높은 특이성을 제공합니다. Human에 반응하며, Rat 및 Mouse와도 높은 유사성을 가집니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA040348-100 Anti-PTPMT1 Antibody, protein tyrosine phosphatase, mitochondrial 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040348-25 Anti-PTPMT1 Antibody, protein tyrosine phosphatase, mitochondrial 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PTPMT1 Antibody
Anti-PTPMT1 Antibody
Target Protein: Protein tyrosine phosphatase, mitochondrial 1 (PTPMT1)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PTPMT1, designed for detection of the mitochondrial protein tyrosine phosphatase.
Alternative Gene Names
- DUSP23
- MOSP
- PLIP
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
FRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGI
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000009723 | 85% |
| Mouse | ENSMUSG00000110860 | 83% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium azide | 0.02% (preservative) |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



