CacheBy
Atlas Antibodies Anti-PTPN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PTPN1 Antibody

상품 한눈에 보기

인간 PTPN1 단백질에 대한 고특이성 폴리클로날 항체로 IHC, WB, ICC 등 다양한 응용에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 40% 글리세롤/PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA012542-100 Anti-PTPN1 Antibody, protein tyrosine phosphatase, non-receptor type 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012542-25 Anti-PTPN1 Antibody, protein tyrosine phosphatase, non-receptor type 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PTPN1 Antibody

Anti-PTPN1 Antibody

Protein Tyrosine Phosphatase, Non-Receptor Type 1


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human PTPN1


Alternative Gene Names

  • PTP1B

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Protein tyrosine phosphatase, non-receptor type 1
Target Gene PTPN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000010574 (67%), Mouse ENSMUSG00000027540 (64%)

Antigen Sequence:

RFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYW

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Genetic Validation
Genetic Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.