
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PTK2B Antibody
상품 한눈에 보기
Human PTK2B 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원으로 정제되었습니다. Human과 Rat에 반응성이 검증되었습니다. Orthogonal validation을 통해 신뢰성 높은 단백질 발현 검증이 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA026091-100 Anti-PTK2B Antibody, protein tyrosine kinase 2 beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026091-25 Anti-PTK2B Antibody, protein tyrosine kinase 2 beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PTK2B Antibody
Anti-PTK2B Antibody
Protein Tyrosine Kinase 2 Beta
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human PTK2B.
Alternative Gene Names
CADTK, CAKB, FAK2, PTK, PYK2, RAFTK
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein Tyrosine Kinase 2 Beta |
| Target Gene | PTK2B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM |
Verified Species Reactivity
- Human
- Rat
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000027839 | 90% |
| Mouse | ENSMUSG00000059456 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



