Atlas Antibodies Anti-PTK2B Antibody
상품 한눈에 보기
Human PTK2B 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원으로 정제되었습니다. Human과 Rat에 반응성이 검증되었습니다. Orthogonal validation을 통해 신뢰성 높은 단백질 발현 검증이 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PTK2B Antibody
Protein Tyrosine Kinase 2 Beta
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human PTK2B.
Alternative Gene Names
CADTK, CAKB, FAK2, PTK, PYK2, RAFTK
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein Tyrosine Kinase 2 Beta |
| Target Gene | PTK2B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM |
Verified Species Reactivity
- Human
- Rat
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000027839 | 90% |
| Mouse | ENSMUSG00000059456 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.