Atlas Antibodies Anti-PTK6 Antibody

상품 한눈에 보기

Human PTK6 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 Western blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, BRK로도 알려진 PTK6 단백질 연구에 사용됩니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036071-100 Anti-PTK6 Antibody, protein tyrosine kinase 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036071-25 Anti-PTK6 Antibody, protein tyrosine kinase 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PTK6 Antibody

Anti-PTK6 Antibody

Target: Protein Tyrosine Kinase 6 (PTK6)
Type: Polyclonal Antibody against Human PTK6
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human PTK6, also known as BRK. The antibody was affinity purified using the PrEST antigen as affinity ligand.

Alternative Gene Names

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	Protein Tyrosine Kinase 6
Target Gene	PTK6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000012987 (78%), Mouse ENSMUSG00000038751 (77%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Preservative MSDS	Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand