Atlas Antibodies Anti-PTK6 Antibody
상품 한눈에 보기
Human PTK6 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 Western blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, BRK로도 알려진 PTK6 단백질 연구에 사용됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PTK6 Antibody
Target: Protein Tyrosine Kinase 6 (PTK6)
Type: Polyclonal Antibody against Human PTK6
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody raised in rabbit against human PTK6, also known as BRK. The antibody was affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- BRK
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein Tyrosine Kinase 6 |
| Target Gene | PTK6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PYPGMSNHEAFLRVDAGYRMPCPLECPPSVHKLMLTCWCRDPEQRPCFKALRERLSSFTSYENPT |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000012987 (78%), Mouse ENSMUSG00000038751 (77%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Preservative MSDS | Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.