원본
Thermo Fisher Scientific DR4 Polyclonal Antibody
상품 한눈에 보기
DR4 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot, IHC, ICC/IF, Flow Cytometry에 사용 가능. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 고순도 제품이며, 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오후 02:04
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA580143 DR4 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific DR4 Polyclonal Antibody
Thermo Fisher Scientific DR4 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99–131aa: VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747257 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
TRAIL-R1 (CD261, DR4)는 type I transmembrane protein으로, TRAIL receptor 1로도 알려져 있습니다. DR4의 리간드는 TRAIL로 확인되었으며, TNF 패밀리에 속합니다. DR4는 다른 수용체(Fas, TNFR1 등)와 마찬가지로 다양한 세포와 조직에서 apoptosis 및 NF-kappaB 활성화를 매개합니다. Apoptosis는 다세포 생물의 정상적인 세포 분화 및 발달 과정에서 작동하는 프로그램된 세포 사멸 과정이며, TNF 패밀리의 사이토카인(TNF, Fas ligand)과 그들의 death domain 수용체(TNFR1, Fas receptor)에 의해 유도됩니다.
For Research Use Only. Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific RANK (CD265) Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TNFRSF14 (HVEM) Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TNFAIP8L3 Polyclonal Antibody568,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific TNFAIP1 Polyclonal Antibody568,000원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.