Thermo Fisher Scientific DR4 Polyclonal Antibody
DR4 단백질을 인식하는 Thermo Fisher Scientific의 폴리클로날 항체로, Western blot, IHC, ICC/IF, Flow Cytometry에 사용 가능. 인간, 마우스, 랫트 반응성. 항원 친화 크로마토그래피로 정제된 고순도 제품이며, 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific DR4 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99–131aa: VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2747257 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
TRAIL-R1 (CD261, DR4)는 type I transmembrane protein으로, TRAIL receptor 1로도 알려져 있습니다. DR4의 리간드는 TRAIL로 확인되었으며, TNF 패밀리에 속합니다. DR4는 다른 수용체(Fas, TNFR1 등)와 마찬가지로 다양한 세포와 조직에서 apoptosis 및 NF-kappaB 활성화를 매개합니다. Apoptosis는 다세포 생물의 정상적인 세포 분화 및 발달 과정에서 작동하는 프로그램된 세포 사멸 과정이며, TNF 패밀리의 사이토카인(TNF, Fas ligand)과 그들의 death domain 수용체(TNFR1, Fas receptor)에 의해 유도됩니다.
For Research Use Only. Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific RANK (CD265) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TNFRSF14 (HVEM) Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific DR4 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TNFAIP8L3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TNFAIP1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|