Thermo Fisher Scientific HPa1 Polyclonal Antibody
Thermo Fisher Scientific의 HPa1 Polyclonal Antibody는 인간 및 랫트 시료에 반응하는 Rabbit IgG 기반 항체입니다. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific HPa1 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.1–0.5 µg/mL
Publications: References
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Rat |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301–331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746509 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Stem cells offer a therapeutic promise for many diseases. In the case of diabetes, stem cells offer the promise that beta cells may be generated ex vivo for the possible transplantation and cure of Type I diabetes (Couri CE, et al.).
For this to happen, stem cells will need to be isolated and expanded, differentiated toward the beta cell lineage, and the differentiated cell progeny used for transplantation may need to be isolated from complex cell mixtures following differentiation.
Appropriate markers targeting cell surface molecules on developing and mature pancreatic cells will be required for such research.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific HSD11B2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HSD17B2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HPa1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HPa1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HOXA6 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|