Thermo Fisher Scientific HSD11B2 Polyclonal Antibody
HSD11B2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB 및 IHC에 적합합니다. 인간, 마우스, 랫트 반응성 보유. 항원 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific HSD11B2 Polyclonal Antibody
Applications
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | - |
| Immunohistochemistry (IHC) | - | 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | 1 publication |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Rhesus monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human HSD11B2 (277–309aa: EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746515 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Corticosteroid 11-beta-dehydrogenase는 cortisol과 cortisone의 상호전환을 담당하는 미소체 효소 복합체입니다. Type I isozyme은 11-beta-dehydrogenase 및 11-oxoreductase 활성을 모두 가지며, Type II isozyme은 11-beta-dehydrogenase 활성을 가집니다. Type II isozyme은 신장 등 알도스테론 선택적 상피 조직에서 활성 글루코코르티코이드인 cortisol을 비활성 cortisone으로 전환시켜 mineralocorticoid receptor의 비정상적 활성화를 방지합니다. 또한 태반 및 고환 등에서는 세포를 cortisol의 성장 억제 및 세포사멸 유도 효과로부터 보호합니다. 이 유전자의 돌연변이는 apparent mineralocorticoid excess syndrome 및 고혈압을 유발할 수 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.