
Atlas Antibodies Anti-CRX Antibody
상품 한눈에 보기
Human CRX 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성(인간-마우스 97%)을 보임. 시각세포 발달 관련 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CRX Antibody
Target: cone-rod homeobox (CRX)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Antibody Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Recombinant Expression Validation): Recombinant expression validation in western blot using target protein overexpression.
Product Description
Polyclonal antibody against Human CRX.
Alternative Gene Names
CORD2, CRD, LCA7, OTX3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cone-rod homeobox |
| Target Gene | CRX |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFK |
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000041578 | 97% |
| Rat | ENSRNOG00000013890 | 96% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
