
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CRX Antibody
상품 한눈에 보기
Human CRX 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성(인간-마우스 97%)을 보임. 시각세포 발달 관련 연구에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036763-100 Anti-CRX Antibody, cone-rod homeobox 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036763-25 Anti-CRX Antibody, cone-rod homeobox 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CRX Antibody
Anti-CRX Antibody
Target: cone-rod homeobox (CRX)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Antibody Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Recombinant Expression Validation): Recombinant expression validation in western blot using target protein overexpression.
Product Description
Polyclonal antibody against Human CRX.
Alternative Gene Names
CORD2, CRD, LCA7, OTX3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cone-rod homeobox |
| Target Gene | CRX |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFK |
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000041578 | 97% |
| Rat | ENSRNOG00000013890 | 96% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



