CacheBy
Atlas Antibodies Anti-CRX Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CRX Antibody

상품 한눈에 보기

Human CRX 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제됨. 인간에 높은 특이성 보유, 시각 관련 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036762-100 Anti-CRX Antibody, cone-rod homeobox 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036762-25 Anti-CRX Antibody, cone-rod homeobox 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CRX Antibody

Anti-CRX Antibody

Target: Cone-rod homeobox (CRX)
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Recombinant Expression): Recombinant expression validation in Western blot using target protein overexpression.

Product Description

Polyclonal antibody against human CRX.


Alternative Gene Names

CORD2, CRD, LCA7, OTX3

Open Datasheet


Technical Specifications

항목 내용
Target Protein Cone-rod homeobox
Target Gene CRX
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFK
Verified Species Reactivity Human
Interspecies Homology Mouse (97%), Rat (96%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
IHC Tooltip
WB Recombinant Expression
WB Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.