
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CREBBP Antibody
상품 한눈에 보기
Human CREBBP 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055861-100 Anti-CREBBP Antibody, CREB binding protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055861-25 Anti-CREBBP Antibody, CREB binding protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CREBBP Antibody
Anti-CREBBP Antibody
CREB Binding Protein (CREBBP)
Polyclonal antibody against human CREBBP, validated for orthogonal expression analysis.
Recommended Applications
- IHC Orthogonal Validation: Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody targeting Human CREBBP.
Alternative Gene Names
CBP, KAT3A, RSTS, RTS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CREB binding protein |
| Target Gene | CREBBP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (84%), Mouse (82%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Data Sheet | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



