
Atlas Antibodies Anti-CREBBP Antibody
상품 한눈에 보기
Human CREBBP 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CREBBP Antibody
CREB Binding Protein (CREBBP)
Polyclonal antibody against human CREBBP, validated for orthogonal expression analysis.
Recommended Applications
- IHC Orthogonal Validation: Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody targeting Human CREBBP.
Alternative Gene Names
CBP, KAT3A, RSTS, RTS
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CREB binding protein |
| Target Gene | CREBBP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (84%), Mouse (82%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
| Safety Data Sheet | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CRELD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CRELD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CREBBP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CREG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CREBZF Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.