CacheBy
Atlas Antibodies Anti-CREG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CREG1 Antibody

상품 한눈에 보기

Human CREG1 단백질을 인식하는 rabbit polyclonal 항체로, 세포 내 E1A 자극 유전자 억제 단백질 연구에 적합합니다. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 면역세포화학 등 다양한 응용에 사용 가능합니다.

카탈로그번호
HPA056390-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056390-100 Anti-CREG1 Antibody, cellular repressor of E1A-stimulated genes 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056390-25 Anti-CREG1 Antibody, cellular repressor of E1A-stimulated genes 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CREG1 Antibody

Anti-CREG1 Antibody

cellular repressor of E1A-stimulated genes 1


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CREG1.


Alternative Gene Names

  • CREG

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cellular repressor of E1A-stimulated genes 1
Target Gene CREG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWLLD
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000040713 (78%), Rat ENSRNOG00000003291 (76%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 농도 및 조건은 사용자가 직접 확인해야 합니다.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.