Atlas Antibodies Anti-CREB3 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA030978-100 | - | Atlas Antibodies HPA030978-100 Anti-CREB3 Antibody, cAMP responsive element binding protein 3 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA030978-25 | - | Atlas Antibodies HPA030978-25 Anti-CREB3 Antibody, cAMP responsive element binding protein 3 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-CREB3 Antibody
cAMP responsive element binding protein 3
Recommended Applications
Product Description
Polyclonal Antibody against Human CREB3
Alternative Gene Names
Luman, LZIP, sLZIP
Target Protein
cAMP responsive element binding protein 3
Target Gene
CREB3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000028466 (93%)
Rat ENSRNOG00000016452 (91%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|