
Atlas Antibodies Anti-CREB3 Antibody
상품 한눈에 보기
Human CREB3 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC에 적합합니다. Luman, LZIP 등 대체 유전자명을 가지며, 고순도의 친화정제 방식으로 제조되었습니다. Human에 반응하며, glycerol/PBS buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CREB3 Antibody
cAMP responsive element binding protein 3 (CREB3)
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human CREB3
Alternative Gene Names
Luman, LZIP, sLZIP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cAMP responsive element binding protein 3 |
| Target Gene | CREB3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTS |
Verified Species Reactivity
Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 일치율 |
|---|---|---|
| Mouse | ENSMUSG00000028466 | 93% |
| Rat | ENSRNOG00000016452 | 91% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CREB3L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CRB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CREB3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CRAT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CRAMP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.