Atlas Antibodies Anti-CPT1B Antibody
상품 한눈에 보기
Human CPT1B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 확보. Human에 대한 반응성 검증 완료. CPT1B 관련 대사 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CPT1B Antibody
Target: carnitine palmitoyltransferase 1B (CPT1B)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human CPT1B.
Alternative Gene Names
CPT1-M, M-CPT1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | carnitine palmitoyltransferase 1B |
| Target Gene | CPT1B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VPRVSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSW |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000078937 (88%) Rat ENSRNOG00000010438 (84%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.