CacheBy
Atlas Antibodies Anti-CPT2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPT2 Antibody

상품 한눈에 보기

Human CPT2 단백질을 표적으로 하는 고품질 폴리클론 항체입니다. IHC 및 WB 분석에 권장되며, RNA-seq 데이터 기반의 정교한 orthogonal 검증을 거쳤습니다. Rabbit IgG 포맷으로, PrEST 항원 친화 정제 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028201-100 Anti-CPT2 Antibody, carnitine palmitoyltransferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028201-25 Anti-CPT2 Antibody, carnitine palmitoyltransferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPT2 Antibody

Anti-CPT2 Antibody

Target: Carnitine Palmitoyltransferase 2 (CPT2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody against human CPT2.


Alternative Gene Names

CPT1, CPTASE


Target Information

항목 내용
Target Protein Carnitine palmitoyltransferase 2
Target Gene CPT2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRF
Verified Species Reactivity Human
Interspecies Identity Mouse (90%), Rat (85%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.