Atlas Antibodies Anti-CPEB3 Antibody
상품 한눈에 보기
Human CPEB3 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CPEB3 Antibody
Target: Cytoplasmic polyadenylation element binding protein 3 (CPEB3)
Product Type: Polyclonal Antibody against Human CPEB3
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against human CPEB3. It is affinity purified using the PrEST antigen as the affinity ligand for high specificity and reproducibility.
Alternative Gene Names
- KIAA0940
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cytoplasmic polyadenylation element binding protein 3 |
| Target Gene | CPEB3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FNLHSLENSLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNSRSSLFPFEDAFLDDSHGDQ |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000111861 | 100% |
| Rat | ENSRNOG00000020689 | 65% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.