CacheBy
Atlas Antibodies Anti-CPEB3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPEB3 Antibody

상품 한눈에 보기

Human CPEB3 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070942-100 Anti-CPEB3 Antibody, cytoplasmic polyadenylation element binding protein 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070942-25 Anti-CPEB3 Antibody, cytoplasmic polyadenylation element binding protein 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPEB3 Antibody

Anti-CPEB3 Antibody

Target: Cytoplasmic polyadenylation element binding protein 3 (CPEB3)
Product Type: Polyclonal Antibody against Human CPEB3


  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against human CPEB3. It is affinity purified using the PrEST antigen as the affinity ligand for high specificity and reproducibility.


Alternative Gene Names

  • KIAA0940

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Cytoplasmic polyadenylation element binding protein 3
Target Gene CPEB3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FNLHSLENSLMDMIRTDHEPLKGKHYPPSGPPMSFADIMWRNHFAGRMGINFHHPGTDNIMALNSRSSLFPFEDAFLDDSHGDQ

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 동일성
Mouse ENSMUSG00000111861 100%
Rat ENSRNOG00000020689 65%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.