CacheBy
Atlas Antibodies Anti-CPED1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CPED1 Antibody

상품 한눈에 보기

Human CPED1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit 유래 IgG 항체이며 PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 검증 완료, Mouse 및 Rat과 부분적 교차 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012058-100 Anti-CPED1 Antibody, cadherin-like and PC-esterase domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012058-25 Anti-CPED1 Antibody, cadherin-like and PC-esterase domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CPED1 Antibody

Anti-CPED1 Antibody

Target: cadherin-like and PC-esterase domain containing 1 (CPED1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CPED1 protein.


Alternative Gene Names

C7orf58, FLJ21986

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cadherin-like and PC-esterase domain containing 1
Target Gene CPED1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQCFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPGLLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGL

Species Reactivity

  • Verified: Human
  • Ortholog identity:
    • Mouse ENSMUSG00000062980 (62%)
    • Rat ENSRNOG00000021840 (57%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.