
Atlas Antibodies Anti-COX6B1 Antibody
Human COX6B1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현을 교차 검증하였으며, 고순도의 Affinity purified 항체입니다. COX6B, COXG 유전자 연구에 활용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COX6B1 Antibody
Target: cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human COX6B1
Alternative Gene Names
COX6B, COXG
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) |
| Target Gene | COX6B1 |
| Antigen Sequence | EDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFP |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000036751 (84%) Rat ENSRNOG00000034161 (84%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COX8A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX6C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX6B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX5B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX6A1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|