
Atlas Antibodies Anti-COX5B Antibody
상품 한눈에 보기
Human COX5B 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합. siRNA knockdown으로 유전적 검증 완료. Rabbit 유래 IgG 항체이며 PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Mouse, Rat과 높은 상동성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COX5B Antibody
Target: cytochrome c oxidase subunit Vb
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Genetic validation by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human COX5B.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cytochrome c oxidase subunit Vb |
| Target Gene | COX5B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVP |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000061518 (87%), Rat ENSRNOG00000016660 (84%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COX6C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX6B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX5B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX6A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COX5A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.