AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-COX5B Antibody
상품 한눈에 보기
Human COX5B 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합. siRNA knockdown으로 유전적 검증 완료. Rabbit 유래 IgG 항체이며 PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Mouse, Rat과 높은 상동성 보유.
- 카탈로그번호
- HPA034517-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034517-100 Anti-COX5B Antibody, cytochrome c oxidase subunit Vb 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034517-25 Anti-COX5B Antibody, cytochrome c oxidase subunit Vb 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-COX5B Antibody
Anti-COX5B Antibody
Target: cytochrome c oxidase subunit Vb
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Genetic validation by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human COX5B.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cytochrome c oxidase subunit Vb |
| Target Gene | COX5B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVP |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000061518 (87%), Rat ENSRNOG00000016660 (84%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.