
Atlas Antibodies Anti-COQ10A Antibody
상품 한눈에 보기
인간 COQ10A 단백질을 인식하는 폴리클로날 항체로, 면역세포화학 등 다양한 연구 응용에 적합. 토끼 유래 IgG 형식이며, PrEST 항원으로 특이적 정제. 인간에서 검증된 반응성을 가지며, 글리세롤 기반 PBS 완충액에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COQ10A Antibody
Target Information
- Target Protein: Coenzyme Q10A
- Target Gene: COQ10A
- Alternative Gene Names: FLJ32452
Product Description
Polyclonal antibody against human COQ10A.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
YEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEV - Purification Method: Affinity purified using the PrEST antigen as affinity ligand
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000029571 (97%)
- Mouse ENSMUSG00000039914 (97%)
Recommended Applications
면역세포화학(ICC) 등 다양한 면역 분석에 사용 가능.
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Species Reactivity | Human |
| Storage Note | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Additional Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
