Atlas Antibodies Anti-COQ10A Antibody

상품 한눈에 보기

인간 COQ10A 단백질을 인식하는 폴리클로날 항체로, 면역세포화학 등 다양한 연구 응용에 적합. 토끼 유래 IgG 형식이며, PrEST 항원으로 특이적 정제. 인간에서 검증된 반응성을 가지며, 글리세롤 기반 PBS 완충액에 보존됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA068931-100 Anti-COQ10A Antibody, coenzyme Q10A 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA068931-25 Anti-COQ10A Antibody, coenzyme Q10A 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human COQ10A.

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
YEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEV
```
Purification Method: Affinity purified using the PrEST antigen as affinity ligand

Highest antigen sequence identity to the following orthologs:

면역세포화학(ICC) 등 다양한 면역 분석에 사용 가능.

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using PrEST antigen
Species Reactivity	Human
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.