
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-COQ2 Antibody
상품 한눈에 보기
Human COQ2 단백질을 표적으로 하는 폴리클로날 항체로, WB와 ICC에 적합. Rabbit에서 생산되었으며 PrEST 항원으로 친화 정제됨. Human에 대한 반응성이 검증되었고, 높은 종간 항원 서열 유사성을 가짐.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056599-100 Anti-COQ2 Antibody, coenzyme Q2 4-hydroxybenzoate polyprenyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056599-25 Anti-COQ2 Antibody, coenzyme Q2 4-hydroxybenzoate polyprenyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-COQ2 Antibody
Anti-COQ2 Antibody
Target: coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human COQ2
Alternative Gene Names
- CL640
- FLJ26072
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | coenzyme Q2 4-hydroxybenzoate polyprenyltransferase |
| Target Gene | COQ2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000029319 (77%), Rat ENSRNOG00000002194 (77%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



