Atlas Antibodies Anti-COQ2 Antibody
상품 한눈에 보기
Human COQ2 단백질을 표적으로 하는 폴리클로날 항체로, WB와 ICC에 적합. Rabbit에서 생산되었으며 PrEST 항원으로 친화 정제됨. Human에 대한 반응성이 검증되었고, 높은 종간 항원 서열 유사성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COQ2 Antibody
Target: coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human COQ2
Alternative Gene Names
- CL640
- FLJ26072
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | coenzyme Q2 4-hydroxybenzoate polyprenyltransferase |
| Target Gene | COQ2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000029319 (77%), Rat ENSRNOG00000002194 (77%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.