CacheBy
Atlas Antibodies Anti-COQ2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COQ2 Antibody

상품 한눈에 보기

Human COQ2 단백질을 표적으로 하는 폴리클로날 항체로, WB와 ICC에 적합. Rabbit에서 생산되었으며 PrEST 항원으로 친화 정제됨. Human에 대한 반응성이 검증되었고, 높은 종간 항원 서열 유사성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056599-100 Anti-COQ2 Antibody, coenzyme Q2 4-hydroxybenzoate polyprenyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056599-25 Anti-COQ2 Antibody, coenzyme Q2 4-hydroxybenzoate polyprenyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COQ2 Antibody

Anti-COQ2 Antibody

Target: coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Supplier: Atlas Antibodies


  • Western Blot (WB) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human COQ2


Alternative Gene Names

  • CL640
  • FLJ26072

Open Datasheet


Target Information

항목 내용
Target Protein coenzyme Q2 4-hydroxybenzoate polyprenyltransferase
Target Gene COQ2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NSGQTAPYYAALGAVGAHLTHQIYTLDIHRPEDCWNKFI
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000029319 (77%), Rat ENSRNOG00000002194 (77%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.