CacheBy
Atlas Antibodies Anti-COPS5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COPS5 Antibody

상품 한눈에 보기

Human COPS5 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. CSN5/JAB1 등 대체 유전자명으로도 알려짐. 고순도 Affinity 정제 방식으로 제작되었으며, Human, Mouse, Rat에 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA004845-100 Anti-COPS5 Antibody, COP9 signalosome subunit 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004845-25 Anti-COPS5 Antibody, COP9 signalosome subunit 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COPS5 Antibody

Anti-COPS5 Antibody

Target: COP9 signalosome subunit 5
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human COPS5.


Alternative Gene Names

CSN5, JAB1, MOV-34, SGN5

Open Datasheet


Target Information

항목 내용
Target Protein COP9 signalosome subunit 5
Target Gene COPS5
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence ANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLS

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity:

  • Mouse ENSMUSG00000025917 (100%)
  • Rat ENSRNOG00000006499 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.