CacheBy
Atlas Antibodies Anti-COQ6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COQ6 Antibody

상품 한눈에 보기

Human COQ6 단백질을 타겟으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG형으로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 고순도와 높은 특이성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051371-100 Anti-COQ6 Antibody, coenzyme Q6 monooxygenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051371-25 Anti-COQ6 Antibody, coenzyme Q6 monooxygenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COQ6 Antibody

Anti-COQ6 Antibody

Target Information

  • Target Protein: Coenzyme Q6 monooxygenase
  • Target Gene: COQ6
  • Alternative Gene Names: CGI-10

Product Description

Polyclonal antibody against human COQ6.

면역조직화학(IHC) 등 다양한 연구용 응용에 적합.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NRVSSISPGSATLLSSFGAWDHICNMRYRAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000011164 (92%)
  • Mouse ENSMUSG00000021235 (92%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.