
원본
Atlas Antibodies Anti-COPB2 Antibody
상품 한눈에 보기
인간 COPB2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 특이적 정제되었습니다. Human에 대해 검증된 반응성을 보이며, 40% glycerol 기반의 PBS buffer에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA036867-100 Anti-COPB2 Antibody, coatomer protein complex, subunit beta 2 (beta prime) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036867-25 Anti-COPB2 Antibody, coatomer protein complex, subunit beta 2 (beta prime) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-COPB2 Antibody
Anti-COPB2 Antibody
Target Information
- Target Protein: Coatomer protein complex, subunit beta 2 (beta prime)
- Target Gene: COPB2
- Alternative Gene Names: beta`-COP, betaprime-COP
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal Antibody against Human COPB2
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
VALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQTIQHNPNGRFVVVCGDGEYIIYTA
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000032458 | 99% |
| Rat | ENSRNOG00000060723 | 99% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



