
Atlas Antibodies Anti-COMT Antibody
Human COMT 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터와 비교한 정교한 Orthogonal 검증 수행. 고순도 Affinity 정제 항체로 인간 및 랫트 반응성 확인. 40% 글리세롤과 PBS 완충액에 보존.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COMT Antibody
Target: catechol-O-methyltransferase (COMT)
Type: Polyclonal antibody against Human COMT
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody against Human catechol-O-methyltransferase (COMT).
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | catechol-O-methyltransferase |
| Target Gene | COMT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Amino Acid Sequence | YCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIY |
| Verified Species Reactivity | Human, Rat |
| Interspecies Homology | Rat ENSRNOG00000001889 (82%), Mouse ENSMUSG00000098892 (82%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COPB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COPB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COMT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COMTD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COMMD10 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|