
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-COLGALT2 Antibody
상품 한눈에 보기
Human COLGALT2 단백질을 타깃으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 고순도 Affinity 정제 및 독립 항체 검증 완료. 사람, 생쥐, 랫드 반응 확인. 안정한 PBS/glycerol 버퍼에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031750-100 Anti-COLGALT2 Antibody, collagen beta(1-O)galactosyltransferase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031750-25 Anti-COLGALT2 Antibody, collagen beta(1-O)galactosyltransferase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-COLGALT2 Antibody
Anti-COLGALT2 Antibody
Target: collagen beta(1-O)galactosyltransferase 2 (COLGALT2)
Type: Polyclonal Antibody against Human COLGALT2
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Alternative Gene Names
C1orf17, GLT25D2, KIAA0584
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | collagen beta(1-O)galactosyltransferase 2 |
| Target Gene | COLGALT2 |
| Antigen Sequence | AFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEI |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Sequence Identity:
- Rat ENSRNOG00000028207 (96%)
- Mouse ENSMUSG00000032649 (95%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



