
Atlas Antibodies Anti-COLGALT2 Antibody
상품 한눈에 보기
Human COLGALT2 단백질을 타깃으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 고순도 Affinity 정제 및 독립 항체 검증 완료. 사람, 생쥐, 랫드 반응 확인. 안정한 PBS/glycerol 버퍼에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COLGALT2 Antibody
Target: collagen beta(1-O)galactosyltransferase 2 (COLGALT2)
Type: Polyclonal Antibody against Human COLGALT2
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - ICC (Immunocytochemistry)
Alternative Gene Names
C1orf17, GLT25D2, KIAA0584
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | collagen beta(1-O)galactosyltransferase 2 |
| Target Gene | COLGALT2 |
| Antigen Sequence | AFSSRQAGIQMYLCNREHYGYLPIPLKPHQTLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEI |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Sequence Identity:
- Rat ENSRNOG00000028207 (96%)
- Mouse ENSMUSG00000032649 (95%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COLGALT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COMMD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COLGALT2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COLEC12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COLEC12 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.