
Atlas Antibodies Anti-COL9A3 Antibody
상품 한눈에 보기
Human COL9A3 단백질을 표적으로 하는 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 검증된 반응성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COL9A3 Antibody
Target: collagen, type IX, alpha 3
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal antibody against Human COL9A3.
Alternative Gene Names
DJ885L7.4.1, EDM3, FLJ90759, IDD, MED
Target Information
- Target Protein: collagen, type IX, alpha 3
- Target Gene: COL9A3
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRP
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000027570 | 98% |
| Rat | ENSRNOG00000009531 | 98% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자 실험에 따라 결정되어야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COLEC11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL9A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL9A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL9A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL9A2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.