CacheBy
Atlas Antibodies Anti-COL9A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL9A2 Antibody

상품 한눈에 보기

인간 COL9A2 단백질을 표적하는 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, 토끼 숙주에서 생산된 IgG 형 항체입니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056316-100 Anti-COL9A2 Antibody, collagen, type IX, alpha 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056316-25 Anti-COL9A2 Antibody, collagen, type IX, alpha 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL9A2 Antibody

Anti-COL9A2 Antibody

Target Protein: collagen, type IX, alpha 2
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human COL9A2.


Alternative Gene Names

  • EDM2
  • MED

Target Information

항목 내용
Target Protein collagen, type IX, alpha 2
Target Gene COL9A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000011502 (92%), Mouse ENSMUSG00000028626 (92%)

Antigen Sequence:
PGKPGRPGTIQGLEGSADFLCPTNCPPGMKGPPGLQGV


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet (PDF)


제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.