
Atlas Antibodies Anti-COL9A1 Antibody
상품 한눈에 보기
Human COL9A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 연구용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 가짐. 40% 글리세롤 및 PBS 완충액에 보존제로 0.02% sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-COL9A1 Antibody
Target: collagen type IX alpha 1 chain
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against human COL9A1 (collagen type IX alpha 1 chain).
Recombinant Protein Epitope Signature Tag (PrEST) 항원을 이용해 제작된 항체입니다.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | collagen type IX alpha 1 chain |
| Target Gene | COL9A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP |
Species Reactivity
| 종 | 반응성 | Antigen Sequence Identity |
|---|---|---|
| Human | Verified | - |
| Mouse | Predicted | 93% |
| Rat | Predicted | 92% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야별 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-COL9A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL9A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL9A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL8A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-COL8A2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.