Atlas Antibodies Anti-COL15A1 Antibody

상품 한눈에 보기

Human COL15A1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA017913-100 Anti-COL15A1 Antibody, collagen, type XV, alpha 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA017913-25 Anti-COL15A1 Antibody, collagen, type XV, alpha 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-COL15A1 Antibody

Anti-COL15A1 Antibody

Target: collagen, type XV, alpha 1 (COL15A1)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human COL15A1, validated for use in multiple applications.
Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
RSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEESSASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPE

Species Reactivity

Verified: Human
Ortholog Identity:
- Rat (ENSRNOG00000060381): 77%
- Mouse (ENSMUSG00000028339): 76%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Purification Method	Affinity purified using PrEST antigen
Storage	Gently mix before use; determine optimal concentrations experimentally