Atlas Antibodies Anti-COL13A1 Antibody

상품 한눈에 보기

인체 COL13A1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 분석에 적합. Rabbit 유래 IgG 형식이며 PrEST 항원으로 정제됨. 인간 반응성 검증 완료, Orthogonal validation 데이터 제공. 안정한 PBS-글리세롤 버퍼에 보존제 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA050392-100 Anti-COL13A1 Antibody, collagen, type XIII, alpha 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050392-25 Anti-COL13A1 Antibody, collagen, type XIII, alpha 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-COL13A1 Antibody

Anti-COL13A1 Antibody

Target: collagen, type XIII, alpha 1
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Orthogonal validation:
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody against human COL13A1.

Open Datasheet

Target Information

항목	내용
Target Protein	collagen, type XIII, alpha 1
Target Gene	COL13A1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLP
Verified Species Reactivity	Human
Interspecies Identity	Mouse (95%), Rat (95%)