Atlas Antibodies Anti-CLTC Antibody
상품 한눈에 보기
인간 CLTC 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 보존성을 가진 클라트린 중쇄 단백질 검출에 유용합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CLTC Antibody
Target: clathrin, heavy chain (Hc)
Type: Polyclonal Antibody against Human CLTC
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody targeting the human CLTC (clathrin heavy chain) protein. Suitable for multiple detection applications.
Alternative Gene Names
- CLTCL2
- Hc
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | clathrin, heavy chain (Hc) |
| Target Gene | CLTC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000004291 (100%), Mouse ENSMUSG00000047126 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.