CacheBy
Atlas Antibodies Anti-CLTC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLTC Antibody

상품 한눈에 보기

인간 CLTC 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 보존성을 가진 클라트린 중쇄 단백질 검출에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059143-100 Anti-CLTC Antibody, clathrin, heavy chain (Hc) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059143-25 Anti-CLTC Antibody, clathrin, heavy chain (Hc) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLTC Antibody

Anti-CLTC Antibody

Target: clathrin, heavy chain (Hc)
Type: Polyclonal Antibody against Human CLTC


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody targeting the human CLTC (clathrin heavy chain) protein. Suitable for multiple detection applications.


Alternative Gene Names

  • CLTCL2
  • Hc

Target Information

항목 내용
Target Protein clathrin, heavy chain (Hc)
Target Gene CLTC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004291 (100%), Mouse ENSMUSG00000047126 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet (PDF)


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.