CacheBy
Atlas Antibodies Anti-CLUH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLUH Antibody

상품 한눈에 보기

Human CLUH 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. CLU1/KIAA0664 유전자와 관련된 clustered mitochondria 단백질 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031505-100 Anti-CLUH Antibody, clustered mitochondria (cluA/CLU1) homolog 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031505-25 Anti-CLUH Antibody, clustered mitochondria (cluA/CLU1) homolog 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLUH Antibody

Anti-CLUH Antibody

Target Information

  • Target Protein: clustered mitochondria (cluA/CLU1) homolog
  • Target Gene: CLUH
  • Alternative Gene Names: CLU1, KIAA0664
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CLUH.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    SRLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRERAIFKVHSDFTAAATRGAMAVIDGNVMAINPSEETKMQMFIWNNIFFSLGFDVRDHYKDFGGDVAAYVAPTNDLNGVRTYNAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGI

Verified Species Reactivity

  • Human

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage & Handling Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.