Atlas Antibodies Anti-CLPB Antibody

상품 한눈에 보기

Human CLPB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. FLJ13152, HSP78, SKD3 등 대체 유전자명 포함. 친화 정제 방식으로 높은 특이성과 재현성 제공. Human, Rat, Mouse 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039006-100 Anti-CLPB Antibody, ClpB caseinolytic peptidase B homolog (E. coli) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039006-25 Anti-CLPB Antibody, ClpB caseinolytic peptidase B homolog (E. coli) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

ClpB caseinolytic peptidase B homolog (E. coli)

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human CLPB

FLJ13152, HSP78, SKD3

항목	내용
Target Protein	ClpB caseinolytic peptidase B homolog (E. coli)
Target Gene	CLPB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWA