CacheBy
Atlas Antibodies Anti-CLPB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLPB Antibody

상품 한눈에 보기

인간 CLPB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에서 독립적 검증 완료. PrEST 항원을 이용해 친화 정제됨. 인간에 높은 반응성을 가지며, 보존성이 우수한 PBS/glycerol 버퍼에 제공됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064571-100 Anti-CLPB Antibody, ClpB caseinolytic peptidase B homolog (E. coli) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064571-25 Anti-CLPB Antibody, ClpB caseinolytic peptidase B homolog (E. coli) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLPB Antibody

Anti-CLPB Antibody

ClpB caseinolytic peptidase B homolog (E. coli)


  • IHC (Immunohistochemistry): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human CLPB


Alternative Gene Names

FLJ13152, HSP78, SKD3

Open Datasheet


Target Information

항목 내용
Target Protein ClpB caseinolytic peptidase B homolog (E. coli)
Target Gene CLPB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GKTIDCKDAIFIMTSNVASDEIAQHALQLRQEALEMSRNRIAENLGDVQISDKITISKNFKENVIRPILKAHFRRDEFLGRINEIVYFLPFCHSELIQLVNKELNFWA

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000019693 (100%)
  • Mouse ENSMUSG00000001829 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.