
Atlas Antibodies Anti-CLNS1A Antibody
상품 한눈에 보기
인간 CLNS1A 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. 면역조직화학(IHC) 및 면역세포화학(ICC)에 적합합니다. 토끼에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CLNS1A Antibody
Target: Chloride channel, nucleotide-sensitive, 1A
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CLNS1A.
Alternative Gene Names
- CLCI
- ICln
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chloride channel, nucleotide-sensitive, 1A |
| Target Gene | CLNS1A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | YTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000012788 | 96% |
| Mouse | ENSMUSG00000025439 | 96% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CLOCK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLNS1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLNS1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLNK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CLN6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.