CacheBy
Atlas Antibodies Anti-CLOCK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLOCK Antibody

상품 한눈에 보기

인간 CLOCK 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 토끼에서 유래한 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 생체 리듬 연구 및 시계유전자 분석에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027565-100 Anti-CLOCK Antibody, clock circadian regulator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027565-25 Anti-CLOCK Antibody, clock circadian regulator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLOCK Antibody

Anti-CLOCK Antibody

Target: clock circadian regulator
Type: Polyclonal Antibody against Human CLOCK


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting the human CLOCK protein, a key regulator of circadian rhythm.


Alternative Gene Names

bHLHe8, KAT13D, KIAA0334

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein clock circadian regulator
Target Gene CLOCK
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (90%), Rat (90%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Antigen Sequence

RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.