Thermo Fisher Scientific CRYM Polyclonal Antibody
CRYM 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot과 ELISA에 적합합니다. 인간, 마우스, 랫트에 반응하며, 고순도의 Affinity Chromatography 정제 항체입니다. 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CRYM Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1–314 of human CRYM (NP_001879.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.75 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2855008 |
Product Specific Information
Immunogen sequence:
MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNR TKENAEKFADTVQGEVRVCSSVQEAVAGADV IITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
Target Information
Crystallins are divided into two classes: taxon-specific and ubiquitous. The taxon-specific crystallins are also known as phylogenetically restricted crystallins. The ubiquitous class forms the major proteins of vertebrate eye lens, maintaining lens transparency and refractive index.
This gene encodes a taxon-specific crystallin protein that binds NADPH and shows sequence similarity to bacterial ornithine cyclodeaminases. Unlike structural crystallins, this protein binds thyroid hormone and may play regulatory or developmental roles. Multiple alternatively spliced transcript variants have been identified for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.