Thermo Fisher Scientific CRYM Polyclonal Antibody
CRYM 단백질을 인식하는 Thermo Fisher Scientific의 토끼 폴리클로날 항체로, Western blot과 ELISA에 적합합니다. 인간, 마우스, 랫트에 반응하며, 고순도의 Affinity Chromatography 정제 항체입니다. 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host/Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1–314 of human CRYM (NP_001879.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1.75 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2855008 |
Product Specific Information
Immunogen sequence:
MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNR TKENAEKFADTVQGEVRVCSSVQEAVAGADV IITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
Target Information
Crystallins are divided into two classes: taxon-specific and ubiquitous. The taxon-specific crystallins are also known as phylogenetically restricted crystallins. The ubiquitous class forms the major proteins of vertebrate eye lens, maintaining lens transparency and refractive index.
This gene encodes a taxon-specific crystallin protein that binds NADPH and shows sequence similarity to bacterial ornithine cyclodeaminases. Unlike structural crystallins, this protein binds thyroid hormone and may play regulatory or developmental roles. Multiple alternatively spliced transcript variants have been identified for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CSMD3 Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific CRYGC Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific CRYM Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific CRYGB Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific CRYBB2 Polyclonal Antibody
627,600원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|