CacheBy
Atlas Antibodies Anti-PSMC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMC2 Antibody

상품 한눈에 보기

Human PSMC2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. 독립적 항체 비교를 통한 검증 완료. Human, Mouse, Rat에 반응하며, Affinity purification으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA049621-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049621-100 Anti-PSMC2 Antibody, proteasome 26S subunit, ATPase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049621-25 Anti-PSMC2 Antibody, proteasome 26S subunit, ATPase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMC2 Antibody

Anti-PSMC2 Antibody

Target: proteasome (prosome, macropain) 26S subunit, ATPase, 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PSMC2


Alternative Gene Names

MSS1, Nbla10058, S7

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein proteasome (prosome, macropain) 26S subunit, ATPase, 2
Target Gene PSMC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000012026 (100%), Mouse ENSMUSG00000028932 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Application
WB Application
Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.