
Atlas Antibodies Anti-PSMC2 Antibody
상품 한눈에 보기
Human PSMC2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. 독립적 항체 비교를 통한 검증 완료. Human, Mouse, Rat에 반응하며, Affinity purification으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PSMC2 Antibody
Target: proteasome (prosome, macropain) 26S subunit, ATPase, 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PSMC2
Alternative Gene Names
MSS1, Nbla10058, S7
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | proteasome (prosome, macropain) 26S subunit, ATPase, 2 |
| Target Gene | PSMC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000012026 (100%), Mouse ENSMUSG00000028932 (99%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PSMC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMB9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMB8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PSMB8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.