CacheBy
Atlas Antibodies Anti-PSMB8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSMB8 Antibody

상품 한눈에 보기

Human PSMB8 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증 완료. PrEST 항원을 사용해 친화 정제된 고품질 항체. 다양한 조직에서 신뢰성 높은 결과 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA050327-100 Anti-PSMB8 Antibody, proteasome (prosome, macropain) subunit, beta type, 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050327-25 Anti-PSMB8 Antibody, proteasome (prosome, macropain) subunit, beta type, 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSMB8 Antibody

Anti-PSMB8 Antibody

Target: proteasome (prosome, macropain) subunit, beta type, 8
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot): Suitable for detection of PSMB8 protein.

Product Description

Polyclonal antibody against human PSMB8, validated for multiple applications.


Alternative Gene Names

beta5i, D6S216E, LMP7, PSMB5i, RING10


Target Information

항목 내용
Target Protein proteasome (prosome, macropain) subunit, beta type, 8
Target Gene PSMB8
Antigen Sequence GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000000456 (88%), Mouse ENSMUSG00000024338 (82%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet (PDF)

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.