
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PSMB8 Antibody
상품 한눈에 보기
Human PSMB8 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증 완료. PrEST 항원을 사용해 친화 정제된 고품질 항체. 다양한 조직에서 신뢰성 높은 결과 제공.
- 카탈로그번호
- HPA050327-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050327-100 Anti-PSMB8 Antibody, proteasome (prosome, macropain) subunit, beta type, 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050327-25 Anti-PSMB8 Antibody, proteasome (prosome, macropain) subunit, beta type, 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PSMB8 Antibody
Anti-PSMB8 Antibody
Target: proteasome (prosome, macropain) subunit, beta type, 8
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Suitable for detection of PSMB8 protein.
Product Description
Polyclonal antibody against human PSMB8, validated for multiple applications.
Alternative Gene Names
beta5i, D6S216E, LMP7, PSMB5i, RING10
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | proteasome (prosome, macropain) subunit, beta type, 8 |
| Target Gene | PSMB8 |
| Antigen Sequence | GVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000000456 (88%), Mouse ENSMUSG00000024338 (82%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Open Datasheet (PDF)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



